DPCstruct | MC45908
Metacluster Properties and Pfam Annotations
| Number of structural domains | 104 |
|---|---|
| Mean domain length (aa) | 193 ± 36 aa |
| Standard deviation of domain lengths | 36.15 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 24.25 |
| Pfam Score | 84.83 |
| Assigned Pfam label(s) | CL0063- CL0106 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817PGE6 | 1-195 | MFAGAEVFRLLQEGATPKDIDRATKKFGFPVGSATLFDEVGIDVAAHIARDMQTVFGARLGDSSMPQLFQDLVKNNLCGRKTGQGLY… |
| A0A7Y2VII8 | 19-196 | GFIGNRMVMPYMREAQMLLLEGATPAQVDGALERFGMAMGPIAVADLSGLDVSYKARQALPDPPDDPANNVADRLVEMGRLGQKTGA… |
| A0A812NYH3 | 485-687 | None |
| A0A812JHX8 | 3-188 | None |
| A0A1Q9CKY1 | 62-292 | None |
| A0A4U5JFI8 | 193-371 | None |
| A0A7S2XNE9 | 58-300 | None |
| A0A7J0GE67 | 946-1156 | None |
| A0A819PYA3 | 269-483 | None |
| A0A6S7NAA5 | 140-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.