DPCstruct | MC45905
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 187 ± 16 aa |
| Standard deviation of domain lengths | 16.24 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 34.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397J0Q0 | 178-365 | WYVENERIVPFDDRVKLDKYKVNLKSDEWILLSRQDNVREILVFPLKHKPNKILVKSVPFWLWVLDEVVNKFFGSFQLKEYPVDCFA… |
| A0A816ACT9 | 1-205 | MQWPVESSITKLYYADIDLGQNFDWETSAFILVAKKEIVRDLILDPMPPWHVSNRLLVQLPVFWETAILICRLLRTELYDRYEEKKI… |
| A0A815MHE0 | 1-161 | None |
| A0A2N0Q321 | 1-196 | None |
| A0A819AZ08 | 1-206 | None |
| A0A2Z6QJG7 | 127-282 | None |
| A0A814VFT3 | 43-226 | None |
| A0A815NAQ1 | 113-313 | None |
| A0A817EHU4 | 1-167 | None |
| A0A819R6U1 | 113-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.