DPCstruct | MC45901
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 166 ± 17 aa |
| Standard deviation of domain lengths | 17.11 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0090 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A4NW61 | 1-188 | MDLRTLLTEKRSEIVAKWARLVFETYAPETSRFLKGEKDRFANPVGDALTRGVEAVYDYLLSGTDSEQVLRHLDDIIRIKAVQDFTP… |
| A0A497JG67 | 7-163 | ERKDKMLKNWQEKLLEKYPIKPVIEITSYIEECTTKIMDKLIEALEKGTYEGVEEPIDDLMRFLAVDKDLTPAQSISMLLYLKTLFL… |
| A0A7C3LRM0 | 2-162 | None |
| A0A318CLA9 | 1-207 | None |
| A0A7C1BLT0 | 2-151 | None |
| A0A1F9MBA9 | 1-161 | None |
| A0A2E7ZM81 | 4-163 | None |
| A0A1V5HU75 | 2-149 | None |
| A0A3A4JEZ3 | 35-197 | None |
| A0A7W0C6C4 | 10-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.