DPCstruct | MC4590
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 88 ± 3 aa |
| Standard deviation of domain lengths | 3.02 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 80.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 63.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0056 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3KE07 | 331-414 | IDARENYWGYPGTIGVASGKIRDGLDYDYLIRVDYQPVLESNTSLIDGDCPAGWFAAGYDEFRSCFLYVGAAATYTSAVKFCEE |
| A0A183HTT2 | 2-90 | ERHTIDGRENYWGYPGTVSVASGKIRDYHDYEYLIRVDYVPVLESNASLIEGNCPAGWFQIGRDEFKSCFLYSGGVATYMAAVKFCQ… |
| A0A0N4T8R3 | 68-152 | None |
| A0A6V7XDZ7 | 71-160 | None |
| A0A6V7WPB8 | 71-160 | None |
| A0A0M3INI1 | 608-692 | None |
| A0A1A9VEZ7 | 22-105 | None |
| A0A3P7J7K2 | 170-261 | None |
| A0A238C4N5 | 1164-1246 | None |
| A0A3P8E5I2 | 419-510 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.