DPCstruct | MC4589
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 104 ± 4 aa |
| Standard deviation of domain lengths | 3.91 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 87.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 54.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183HTF6 | 1-99 | MFQIWDSCKIGIPYHDSESNDAVILGFMVAIFIQKYLYAIDDYQPLCVAHFHEWQAGIGLILSRLWKTNVSTIFTTHATLLGRYLCA… |
| A0A0N4YN29 | 144-244 | LDQWKKEMWSVTRVGVPWDDRESNDCIILGFMVATFLQKFAEATAFMKPLIVGHFHEWQAAAGLIMSRLWKLDISLVFTTHATLLGR… |
| A0A7R9J9N9 | 134-238 | None |
| A0A183B1M4 | 90-200 | None |
| A0A5B7EH34 | 173-273 | None |
| M7AKR7 | 410-513 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.