DPCstruct | MC45889
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 126 ± 17 aa |
| Standard deviation of domain lengths | 17.37 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 34.05 |
| Pfam Score | 95.71 |
| Assigned Pfam label(s) | PF06507- CL0405- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A396HVV5 | 3-119 | AVELVVKSMAFEVLYYPRANWIDFVEDANVVDDGMKISWTSGMKVKLPLKKEESSNSKMIFYQPRGTNSDVYKAPSNVPNWRMLQVK… |
| R7TZR6 | 71-156 | IKYHDMADVIDFIILRQTYESAIRHRWKVGDRFRSLIDDAWWIGEIVTQEPFSEEYPDSQFQCFNVKWDTGEHEKMSPWDLEPIDE |
| A0A453SNW3 | 3-101 | None |
| A0A2P2MQ06 | 106-213 | None |
| A0A4S8IX53 | 9-123 | None |
| A0A0B2QBF3 | 251-384 | None |
| A0A0B2PA99 | 86-205 | None |
| Q8H506 | 569-661 | None |
| A0A5B6VZZ1 | 75-218 | None |
| A0A1I8IT30 | 207-310 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.