DPCstruct | MC45888
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 73 ± 5 aa |
| Standard deviation of domain lengths | 5.07 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 53.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A396HVS0 | 1-77 | MSNRLGPSEPKELFPLANGLMRSVIDVHYYNIFNDLFENMIAQQNIVFIYNNRSSELNFITTSNGPLTFVGEWASDW |
| A0A835C8J2 | 330-405 | NRLAIANQTELLQFAGNFTGTVLDVHYYNLFDSKFDTLTVQQNIDFVRNNRSADLKAITNQNGRPLTFVGEWAAAW |
| A2Z6J5 | 547-611 | None |
| A0A803LHC9 | 599-666 | None |
| A0A396HRT5 | 135-204 | None |
| A0A6A6ND89 | 133-206 | None |
| A0A811MY17 | 153-235 | None |
| A0A6A5MKZ4 | 378-447 | None |
| G7KA34 | 236-307 | None |
| A0A444CVR6 | 270-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.