DPCstruct | MC45887
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 123 ± 11 aa |
| Standard deviation of domain lengths | 10.91 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 70.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 52.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A396HMY4 | 1-116 | MCLRRVCRLLLLPHTLWVAFAKLYEEHTDLANARVIFDKAVQVNYKTVDNLASVWCEWAELELKHENFKGALELKRRATAEPSVEVK… |
| A0A161ZL55 | 404-526 | LETYTQAVRTIDPMKAVGKPHTLWVALAKLFETHNGINDARVIFDEAVQVGYKAVDNLASVWCEWAEMELRHKNFKVALDVMRRATA… |
| A0A2U1M3X9 | 254-356 | None |
| X6LS12 | 1-150 | None |
| A0A4U5NES3 | 45-167 | None |
| A0A6A6LX63 | 198-322 | None |
| A0A816IV61 | 293-414 | None |
| A0A6V7PA75 | 1-125 | None |
| A0A7N2L7S9 | 281-405 | None |
| A0A7S3ME08 | 2-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.