DPCstruct | MC4588
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 130 ± 23 aa |
| Standard deviation of domain lengths | 23.02 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.37 |
| Pfam Score | 98.96 |
| Assigned Pfam label(s) | PF10149- PF04194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2CNU3 | 12-115 | DTEVTDLESIAKKVSKEEARFRMFKEAMKSAPDQVIRFQRDGKPIWLSDNPVEVKNCEVCGAERVFEFQVTPQLLCHLKLDTIGELN… |
| A0A183HSW3 | 9-123 | GDLEDLEDFVDKDMAFKYFNKVVALNPEQVLRYSRGGEPLLATDHAPLAETVPPCSLCGSERQFELQLMPHLLALIGVDDLGKSIDW… |
| A0A6J1WUZ9 | 39-190 | None |
| A0A368FNR9 | 18-141 | None |
| A0A3M6WRQ3 | 416-577 | None |
| A4RZH5 | 25-174 | None |
| A0A0B1PLD3 | 7-100 | None |
| A0A7R9TN02 | 274-403 | None |
| A0A1R4ABQ2 | 131-275 | None |
| M2RIV2 | 121-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.