DPCstruct | MC45877
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 242 ± 36 aa |
| Standard deviation of domain lengths | 36.45 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0472 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D5ZFE2 | 96-345 | ADEDAARQFAGFLGRVGGHIGAAAGLGRVEGFSVREMFSEVFKRHPDEEVDAYFSIGSPATTPSLADLGTAWPRPWVFARAATLSVL… |
| A0A7T6ZBG0 | 1-298 | MSEDGEKIGPYTEDDMLHFYNDHIIRMDTYVWQEGLPEWNYFQESLYIDNTRQADYTAKSVFDQATTRVNQMVGEEGAMNVQLRDVF… |
| A0A538RBA2 | 20-201 | None |
| C0DBA2 | 3-245 | None |
| A0A1Q9SFA3 | 6-195 | None |
| A0A851GJU8 | 13-270 | None |
| A0A2E9IMY5 | 20-317 | None |
| A0A355V2H3 | 3-219 | None |
| Q2G1C5 | 9-285 | None |
| A0A2N1QHB3 | 15-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.