DPCstruct | MC45871
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 88 ± 6 aa |
| Standard deviation of domain lengths | 6.12 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 55.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820M9B8 | 1-92 | EDYWYTNVTRTVDSGEIYPCKEIYFKKNTDIPIQLTEVRHVAWGVIQVITNLTIITIGKPDEKYFDSIRKNWSIACRDINLGLIYNP… |
| A0A814ZKT0 | 138-221 | HSNQSKENEDYWYSDEKCRLSSGEMVPCQEIYFRRGTEIPLRTTRVDYNIVALVQKTTAYEILSIGEPDEKYFDSIPKNWTESC |
| A0A822FCR7 | 67-150 | None |
| A0A821S0E5 | 137-233 | None |
| A0A820D412 | 23-110 | None |
| A0A820Q5L2 | 65-162 | None |
| A0A818RZN0 | 391-479 | None |
| A0A818TH12 | 254-335 | None |
| A0A816KP56 | 482-559 | None |
| A0A819H976 | 57-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.