DPCstruct | MC45868
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 228 ± 27 aa |
| Standard deviation of domain lengths | 26.66 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A270P5R8 | 265-488 | ESLFKESFTSYFDNLRTGSGSIFKYLISQLPLEDRQSLEYGKQRFYSVRSAIDEDRYSQTPEKIEAHKGRHGILLRSEYQQKVTYYE… |
| A0A2H2Z3A9 | 6-255 | DATSKHWHSSDRAIKYREMAKRFHLLGQINTLFSNAFNQKLEQLKAAYREYLCQGMSHLPLRWREALEYGYVQFFRLKMRGSGPGDP… |
| B7XMQ1 | 142-377 | None |
| A0A105T3F8 | 35-259 | None |
| A0A2G0XB50 | 653-856 | None |
| A0A3G7U9W0 | 2-178 | None |
| A0A1B5EW97 | 906-1114 | None |
| A0A893DDB6 | 458-753 | None |
| A0A1S1UX45 | 452-662 | None |
| A0A109LGS2 | 4-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.