DPCstruct | MC45867
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 68 ± 3 aa |
| Standard deviation of domain lengths | 3.46 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 76.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 96.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E6N3E9 | 1-68 | MVELGYTQAVDIKLIADSQDNRKGHYGEDNNIYLNDVNLNNTKDLATTLGHETSHAIDNQDPSINTNP |
| A0A5E6N3V7 | 1-64 | MVELGYTQAVDIKLVADSQDNRKGHYGEDNNIYLNDANLNNTKDLATTLGHETSHAIDNQDPSI |
| A0A5E6NPP7 | 1-70 | None |
| A0A5E6NH92 | 2-62 | None |
| A0A5E6NFH1 | 1-71 | None |
| A0A5E6N696 | 2-65 | None |
| A0A5E6NGX7 | 1-70 | None |
| A0A5E5QJ17 | 1-71 | None |
| A0A5E5QHR3 | 1-71 | None |
| A0A5E6NWI5 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.