DPCstruct | MC4586
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 168 ± 11 aa |
| Standard deviation of domain lengths | 11.21 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 55.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0715 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7F876 | 102-269 | QVEDGDVFDFRGMRLDWFRLQAYTSVSKASLGIADHKELGKMMNTIIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEKMFQQCLELP… |
| A0A183HSI7 | 1-152 | MSRSSFTFNHDRRLAVTMNTTVFHLKMIDLIDEMLRETSDLSIYCFYAQQFETQLHQCLQLPSQSRYTVSFAHICSNFPSALHDLCP… |
| A0A4W3GXE1 | 66-220 | None |
| A0A3P7W458 | 66-242 | None |
| A0A1S4ERC4 | 94-255 | None |
| A0A6M2DZN1 | 233-413 | None |
| V9IHV6 | 28-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.