DPCstruct | MC45857
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 162 ± 13 aa |
| Standard deviation of domain lengths | 12.58 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 72.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.26 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0220- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819V6J7 | 3-153 | NEYKIIATETICEKYGQIIEVQYEYDENNRGENKKYHIKWSRQEYERTASRLYKPSMAYDKFIKVLRTFMMGKYAIEDVPEAFRLLD… |
| A0A821QKM6 | 22-176 | VWAYEIAEFHEKKENGQVVAVEYEFLHKADENDKKNFVCPRQIISKENFSKHQQIEITWDEFFVVLKAFILGDQCELNDIDNAFKIL… |
| A0A813XBB5 | 2-183 | None |
| A0A816C267 | 7-173 | None |
| A0A814MJK0 | 63-216 | None |
| A0A816H2B8 | 25-172 | None |
| A0A815LLP4 | 4-155 | None |
| A0A814TXV0 | 8-171 | None |
| A0A816RB20 | 1-177 | None |
| A0A821M0A7 | 3-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.