DPCstruct | MC45854
Metacluster Properties and Pfam Annotations
| Number of structural domains | 846 |
|---|---|
| Mean domain length (aa) | 192 ± 35 aa |
| Standard deviation of domain lengths | 34.67 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 13.92 |
| Pfam Score | 87.40 |
| Assigned Pfam label(s) | PF18312- CL0707- CL0509- CL0063- PF05226 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9LRC9 | 343-531 | ETLVAGATETTKTNKPKVLMFVMSFCPYGQQMMAVMKPVFELFGDKVDIEPHFVIYGSASYKGKESSYCMGDLCSMHGLYELEEDIR… |
| A0A0G0PFF4 | 2-157 | VEFSDFECPFCERFFKETLPQIKKEYIDTGKVKLTYRHFPLDFHAAAMPAALASECANEQGKFWEYHDKIFTEQSKISGKTGEIISQ… |
| A0A1B8F6N8 | 3-172 | None |
| A0A6L9J0E3 | 100-295 | None |
| A0A7S8IXZ5 | 19-206 | None |
| A0A1N7DID2 | 160-355 | None |
| A0A2W1UQM8 | 22-224 | None |
| A0A7S4SH30 | 31-218 | None |
| A0A1D2NCR9 | 197-417 | None |
| A0A258VQL5 | 197-391 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.