DPCstruct | MC4585
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 175 ± 36 aa |
| Standard deviation of domain lengths | 36.49 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 86.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.58 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | CL0715- PF07159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J1X2Z1 | 4-133 | TFKEAGSDAENKAVTELCLRGLQLLSSWCSVLTELCSWKLLHPTDHASNQRCPPDAEEYERATRYNYTSEEKFAMIEVIAMIKGLQV… |
| A0A183HSB2 | 41-197 | MREQHLEYVTNLSRLNNEVAVYDRDGPRSDSENREMTQLMLDGIQFLCSWTSDVVETISWKLLHPTDHRTNSACPETAEEYERATKY… |
| A0A1I8FKE2 | 235-418 | None |
| A0A3P7LSF4 | 118-312 | None |
| A0A448WRQ6 | 3-158 | None |
| A0A6I9N4M3 | 254-453 | None |
| A0A183KCP3 | 15-250 | None |
| A0A183WVG1 | 1-136 | None |
| A0A388L3X4 | 268-512 | None |
| A0A0R3WX65 | 2-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.