DPCstruct | MC4584
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 139 ± 13 aa |
| Standard deviation of domain lengths | 13.07 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K4FC83 | 69-211 | VVREQINRILKTIPISLEEFENSLIKFNPYDVPSMWSKRENRLRVDMLHNHPALIELRNDVRKRHQGHVYENRLNILSNSAPLEYIP… |
| A0A183HS42 | 8-153 | VVRKQIDVCLLEKPVTIEKLEELLAAHSYPHMKKIWEKERSAKEAEELQSDAVKSGAKIRKYFNYDKNTSLLFWFFRELREHLRPGI… |
| A0A0K0EF02 | 566-704 | None |
| A0A6P9AF91 | 678-848 | None |
| A0A2U3EIX8 | 505-650 | None |
| A0A7T8QV19 | 99-226 | None |
| A0A4Y7MQ57 | 471-605 | None |
| A0A1Y1VCR4 | 470-598 | None |
| A0A821JPP1 | 194-312 | None |
| A0A673Y8G4 | 379-513 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.