DPCstruct | MC45837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 263 ± 28 aa |
| Standard deviation of domain lengths | 28.43 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6L274 | 302-566 | RRVSSTDTNHPCEPTRLSRWPTEPRLLRENNFMSKLFTAADIVMALVPVAFIVIGALAASLNGKPTADNGLGKNIEYAMRIGPTIFP… |
| A0A1L9TER8 | 1-312 | MAVPAQPTTHQSGLQLLPTSPRSASPNHLESTDKGPSEGQSESSSSRHASSAEPAKSPVKGRWPGRPQRLRNNARADIYSTALEEIS… |
| A0A0B4HQ43 | 1-260 | None |
| A0A428UBM4 | 382-646 | None |
| A0A167BIE9 | 32-280 | None |
| A0A0C3DYK3 | 42-352 | None |
| A0A1B8B022 | 3-241 | None |
| A0A428V2C8 | 1-227 | None |
| A0A3M2SGH8 | 26-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.