DPCstruct | MC45836
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 222 ± 23 aa |
| Standard deviation of domain lengths | 23.43 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 38.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A7ARJ2 | 22-234 | PISLLPTSAAAFTPRSKVKVVLASQVEPWLTQTLERVRPVERPLNNVQQQTSFLTETLSGPNAMWSLCSIMVPKATDSELRKDSNPP… |
| A0A366QWG6 | 2-231 | VQQPLPASDAALSPRPSSVDVVLGSKVEPWLTATLERISRGERSLNSAFQHRTYLSETVSSPGAIWTLTSLMLPTTPESGLKRDADN… |
| D4D2B4 | 159-423 | None |
| A0A135TTN9 | 1-203 | None |
| A0A4P7NW06 | 258-443 | None |
| A0A094IGA6 | 3-238 | None |
| A0A1B8A586 | 2-231 | None |
| L7J8U3 | 1-201 | None |
| A0A1V6PK22 | 1-217 | None |
| A0A2H4S9S5 | 1-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.