DPCstruct | MC45834
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 108 ± 16 aa |
| Standard deviation of domain lengths | 15.79 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J4IUC6 | 1-103 | MVALLTTAPLSFHTMDDTHFFPSTGQAVMNATYDFVTANGGAQRTGLPIADPVSTAGVTQRTFQRARIDRSDVTGELTLGAIGPEYL… |
| A0A3B9Z0T1 | 46-143 | EGRRPFAASPVFDSTPGHRYFQETGHGLHNAFFTYWTENGGLDLFGYPTSEEMEENGVVVQYFQRARLEYRSVRPEGSRVQLGLVGD… |
| A0A426TQE4 | 118-241 | None |
| A0A6J4MF04 | 103-230 | None |
| A0A7W1YNR2 | 255-344 | None |
| A0A7W1TNL6 | 109-220 | None |
| A0A2N5KJ27 | 497-604 | None |
| E1IDV6 | 395-513 | None |
| A0A2N5JZR3 | 16-146 | None |
| A0A7C2PPK5 | 17-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.