DPCstruct | MC45830
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 357 ± 53 aa |
| Standard deviation of domain lengths | 52.56 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 23.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P2MMJ3 | 2-406 | MWHLVHSSWILHVSCNKRRVACIAALLSSVLHTSVFSDGSMHGTSSASGPLKWFIENVLEEGTKSPRTIRLAALHLTGMWLSHPKEI… |
| A0A453JBC6 | 85-487 | MMQLVKSSWLLHLSCNKRRVAPIAALLSAILHPSIFPNLEMHQTNEKGPGPLKWFVETLLNEGSKSPRTIRLAALHLSGLWLMYPQT… |
| A0A1S8VIH4 | 89-423 | None |
| Q54XF8 | 935-1413 | None |
| A0A7J6Q8L4 | 2-364 | None |
| A0A287Q4D6 | 2-322 | None |
| H2YWT0 | 13-315 | None |
| A0A453JBG0 | 262-592 | None |
| W5JCD0 | 224-505 | None |
| A0A834I126 | 116-471 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.