DPCstruct | MC4583
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 74 ± 9 aa |
| Standard deviation of domain lengths | 8.66 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 93.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 52.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3JIK8 | 21-87 | LPFGYPIPTIGRDDELRRIHRILQEHNLYSRGRFGGWKYEISNQDHSFAMGMQWVNYLLYGIPETLY |
| A0A183HRS0 | 1-61 | MIQRDRELTRAHRILEKHKIYSRGRFGGWKYEVSNQDHCFIQGKEIIDRLLLGEPETLTLK |
| I8TMG9 | 71-153 | None |
| A0A5N7EFI6 | 74-137 | None |
| A0A2P2GXX6 | 371-453 | None |
| A0A0R3QAG0 | 89-153 | None |
| A0A4D9D924 | 223-295 | None |
| A0A7S2T6F3 | 163-241 | None |
| A0A5B0QWP5 | 108-189 | None |
| A0A1V6HCE4 | 65-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.