DPCstruct | MC45829
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 294 ± 50 aa |
| Standard deviation of domain lengths | 49.95 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P2MJL3 | 76-382 | SKKAKKTVKDQLAGNEIQAQRLQFYIDIEKLQNEFVLTSAEYWLSLSNVKWTFSGKDKVPSDVIDLLVQTNSYEMAFTVILQFWKGS… |
| A0A0C9RAX6 | 10-244 | QSEPSELIAVLANVGLYTTALHLCEEFKISKCSVLETLSSQSLRLSETENNDAWDWLIQNNVYDIVGCSGNAADVSWRLLERLTLDN… |
| A0A7S0CDT0 | 1-278 | None |
| A0A5K3FQT8 | 2-344 | None |
| A0A2G5BKT2 | 519-842 | None |
| A0A7R9E6G1 | 639-960 | None |
| S9WEK8 | 766-1072 | None |
| A0A7R9WB39 | 2-335 | None |
| A0A0D0VCX7 | 797-1115 | None |
| A0A0N4VVR0 | 36-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.