DPCstruct | MC45828
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 181 ± 8 aa |
| Standard deviation of domain lengths | 8.10 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 84.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08429 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A402EGF9 | 1-175 | NLLDDVEEFHERAQEAMMDEIPDSSKLQMLIDMGSGLYVELPELPRLKQELQQARWLDEVRVTLSDPQRVTLDVMKKLIDSGVGLAP… |
| A0A1S3XBD4 | 142-315 | YHKDAVSWIARANRALLGISEREDQETVFDELTCLLKDASLLRVKVEELPCLDVELKKAGCRVKALKALRCKMSMDYIEQLLMEASI… |
| K7LMP3 | 965-1155 | None |
| B4Q455 | 256-427 | None |
| A0A453TED3 | 257-449 | None |
| A0A0S7F2H8 | 151-337 | None |
| Q9VMJ7 | 1001-1185 | None |
| A0A1D6GXG4 | 28-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.