DPCstruct | MC45827
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 127 ± 20 aa |
| Standard deviation of domain lengths | 19.52 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 46.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P2MFT0 | 1-124 | MIDIAEATMVMLSVIRNGGLAPGGFNFDAKLRRESTDVEDLFIAHIGGMDTLARGLHNAAKLIEDGHLSELVRKRYQSFDAEFGQLV… |
| A0A1V5IVA4 | 9-145 | RGDYQNGWDTDQFPIDPFELIQAWIEIIRGGGLGTGGTNFDAKTRRNSTDLEDIAIAHISGMDAMARALESAAKLLEESPYKKMKAE… |
| A0A7E4S0R0 | 265-358 | None |
| A0A6A5L3P0 | 793-926 | None |
| A0A821WKT5 | 302-436 | None |
| A0A498I6D4 | 375-518 | None |
| A0A5J5AZX9 | 383-526 | None |
| A0A4Q2RG53 | 693-832 | None |
| A0A1D6G3A7 | 19-142 | None |
| A0A2W1BYK8 | 705-840 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.