DPCstruct | MC4582
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 114 ± 13 aa |
| Standard deviation of domain lengths | 13.21 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 57.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0715 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453IZS0 | 56-165 | FTATIGTLTDLGFLWFREFYLESSRVIQFPIECSLPWMLVDHVIESQDAGLLESILIPLDLYNDSAQHALTYLKQRFLYDEIEAEVD… |
| A0A183HRJ5 | 2-116 | LNNIFAETLSECCELSQLWFREFYLEMTMGRRIQFPIDMSMPWILTDYILTSQEPSLIESIFYQLDLYNDAADYALKKFKKQFLYDE… |
| A0A1I8FKE2 | 508-628 | None |
| A0A6P7GPG7 | 81-223 | None |
| I1NCF6 | 601-724 | None |
| A0A662XTB0 | 434-559 | None |
| A0A5B7DH87 | 592-711 | None |
| A0A821IWW4 | 15-128 | None |
| A0A427AHD8 | 149-254 | None |
| A0A843U798 | 5-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.