DPCstruct | MC45818
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 113 ± 15 aa |
| Standard deviation of domain lengths | 15.46 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 94.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R1WJC2 | 186-313 | RLIADIFKYCKAEIPKWNTISISGYHMAEAGASPAQEIAFTLADGIEYVRTAVAAGMDVDDFAPRLSFFFVSRTTILEEVAKFRAAR… |
| A0A6N9XRK3 | 1-105 | ISGYHIAEAGANPISQLAFTLANGFTYVESYLARGMDVDDFAPNLSFFFSNGMDPEYNVLGRVARRIWAVAMRDRYGANERSQKLKY… |
| A0A0V0S6J5 | 262-361 | None |
| A0A7D9E586 | 232-351 | None |
| A0A7J5D4P2 | 222-330 | None |
| A0A1V9ZCN3 | 249-345 | None |
| A0A847ZLK7 | 3-112 | None |
| A0A535AGQ0 | 238-334 | None |
| A0A7Y4YJ54 | 3-142 | None |
| A0A0M3IVA6 | 153-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.