DPCstruct | MC45815
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 91 ± 12 aa |
| Standard deviation of domain lengths | 11.84 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 53.43 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0023- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183WZX4 | 12-105 | EVVEILKNTARREGLTMPVELAKRIAISSDRNLRRALLYAEVARWQHSPMTPDQSVQLPDWQVFISETASAILVEQSPKKILEVRNR… |
| A0A7J9KFU1 | 1-101 | YQIVKVLEFIGKKEGLQLPSGFAARIAEKSNRNLRRAILSFETCRVQQYPFTSNQAILPMDWEEYISEIATDIMKEQSPKRFLPSTL… |
| A0A448X9G8 | 10-104 | None |
| A0A818PXQ5 | 2-77 | None |
| A0A445B1P3 | 442-555 | None |
| A0A183MCY8 | 66-154 | None |
| A0A4Y2NVQ1 | 173-275 | None |
| A0A6P4DH52 | 189-267 | None |
| A0A452S0Q3 | 81-174 | None |
| A0A0Q3P0B0 | 117-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.