DPCstruct | MC45814
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 94 ± 16 aa |
| Standard deviation of domain lengths | 16.18 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9KD93 | 2-96 | FGLVKELVQVPLERKQKNASPLPYHGWVGPCSQVSLLYEGFGLGDASNYDSVKRFAQLMWPDGHPRFCDTVHTLATQMEELNKLIWL… |
| A0A4S8KEN4 | 18-119 | TPQLHGSILEMAAEELFPLPLEVKIKNTSDKPFGGYLGQISGFDYESLAITDAPLPHGAPRFCGLLWPDGNPDFCEKAYTFSKKLGQ… |
| A0A5P1F091 | 49-156 | None |
| A0A1R3JZ93 | 347-448 | None |
| A0A1R3KE30 | 2-100 | None |
| A0A7N2KWF4 | 144-212 | None |
| A0A2G3B321 | 153-231 | None |
| A0A0B2PFP0 | 38-176 | None |
| A0A6V7P4T2 | 83-173 | None |
| A0A453C6Z7 | 43-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.