DPCstruct | MC4581
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 62 ± 6 aa |
| Standard deviation of domain lengths | 6.10 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 53.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7LQB4 | 1-70 | MQLFINLPTENLEMAIPAYMWLKDDDGADIKGPSMVQGREGSIEVIGFNHAISLPVDSHNGKIMGRALDQ |
| A0A378GRU2 | 1-65 | MAIPGNMWLYDDGVALIKGGCDVQNREFSIEFKGFHHNLSIPTDNATGKPTGMRQHSSMLVIKEF |
| A0A2I8NUQ9 | 1-56 | None |
| A0A4U9D5B6 | 1-67 | None |
| F5RU80 | 45-102 | None |
| A0A822PAR3 | 1-57 | None |
| A0A2X3KKE6 | 1-65 | None |
| A0A377W2Y5 | 261-330 | None |
| A0A6L3XUU5 | 1-57 | None |
| A0A831GJ13 | 1-52 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.