DPCstruct | MC45809
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 155 ± 36 aa |
| Standard deviation of domain lengths | 35.91 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 93.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03069 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A087E2I1 | 121-276 | EHLSTVPPGDFGGNLDINLMVEGTRLYLPVFVDGAGLYAGDPHFAQGDGEVALTALEASLEADLRVGVIAGPDFTRRFGVLQGPLLE… |
| A0A1Q9SBM4 | 176-311 | MDTPEMRSRATCYLGVNVEGALFSIGDGHARQGEGESCGVAVEAAMDVTMIVELIKGGAPAWPRIEDDTHIMTVGSGRPLDDAWRAA… |
| A0A5S9NBX9 | 585-772 | None |
| A0A542MX95 | 218-374 | None |
| A0A7C6SBH7 | 75-257 | None |
| K2D5C0 | 125-289 | None |
| A0A0W1QII6 | 1-96 | None |
| A0A0K2RHA6 | 51-205 | None |
| A0A7W5LL46 | 241-428 | None |
| A0A6L7ZY73 | 318-468 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.