DPCstruct | MC45808
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 173 ± 21 aa |
| Standard deviation of domain lengths | 20.68 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 18.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6ZV55 | 11-186 | TAKEMLIELLTNSKLLEDEEIKVMLKDMALQNNKKEDKCLSINTPIIIDTQCRLFFPMYSDKEVKMSYLPKTVYIFFLLHHTGVEFK… |
| A0A4Y3IPY2 | 36-183 | SFEIALQISQREDSLEFDLKNRRLFVKGIEIPMAKTPLFYYYWYAKRKQMGDEPYINPSKMRPDTIAGAQLADIMHRYNGTDRTIEE… |
| A0A6B2D678 | 140-324 | None |
| A0A239X4F9 | 203-389 | None |
| A0A5K7S8H3 | 369-583 | None |
| A0A2D5PEP5 | 236-387 | None |
| A0A7C7CDN1 | 221-379 | None |
| A0A0D0IZW0 | 276-490 | None |
| A0A1V6J8S6 | 84-265 | None |
| A0A412XC50 | 296-503 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.