DPCstruct | MC45807
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 332 ± 59 aa |
| Standard deviation of domain lengths | 59.13 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401H6N4 | 73-429 | PAKFPRSFTRAYLSNIPDYTHGIINTIVYALPAVHCGEESAAAATSLLNTGIWHDDEEFCYTYTLLRSNDIPRYLGCRLVSKEAIHG… |
| A0A5N5Q1E0 | 108-547 | KPVGDIDPSTFPWTYDGIHMGNVPEYVGGLLTAAMYGRPLLREDTPSQMRFNMCFTTSRFPSREHYLAEYMLMHNEKRIADHFALER… |
| R1ETX4 | 1-229 | None |
| A0A4S9ICW1 | 79-396 | None |
| A0A6S8BSG7 | 207-455 | None |
| A0A4Y9YZJ6 | 533-849 | None |
| A0A3N2PYM9 | 31-290 | None |
| A0A6A6BMM8 | 2-209 | None |
| G2YGF4 | 191-580 | None |
| A0A4S8LPK4 | 552-914 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.