DPCstruct | MC45800
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 242 ± 35 aa |
| Standard deviation of domain lengths | 34.84 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 73.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.65 |
| Pfam Score | 97.71 |
| Assigned Pfam label(s) | PF14479- PF17046 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D8Q4F4 | 607-820 | TEHEYIKCYSWIQGIRFSAVFETDFGFSFCKLNAVATHFSRWGTAMGFTSSSSSAPSAEECSEENVRKAKVCLSAINKAFSRAFEDG… |
| A0A2T6ZSG3 | 1-220 | MESTGVTLGITGLAGLFTTCLQLFDLVSTAKSHGSACQTLLCKLEVEQVFLLKWGEAIGIFNSQGPDHEQRNETYNKRLGDILIRRA… |
| A0A2V1DBQ1 | 18-336 | None |
| A0A4Q4W844 | 56-241 | None |
| A0A2V1D5S8 | 1-296 | None |
| A0A3N4JAS8 | 12-230 | None |
| A0A1J9RX25 | 1-284 | None |
| A0A6G1IYE6 | 155-521 | None |
| A0A4S9MVC9 | 10-248 | None |
| A0A4S9NE19 | 9-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.