DPCstruct | MC4580
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 75 ± 7 aa |
| Standard deviation of domain lengths | 7.43 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 59.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7HX59 | 14-92 | AQPFEYAPDVLSDDVQELAASTNNENYAAKMLGYNRKIFGDMIHAMKRYNELRGNDNVVWHDDGDVEFNGTIIDNMHNW |
| J5C5T6 | 2-63 | AASTNNPNFAAKMLGYDRDTFGDMIHSMKADLNLGGADNVIWHDNGDVEFKKQIIGNMHDYN |
| A0A2I8ENW1 | 10-82 | None |
| A0A6S7C948 | 110-181 | None |
| A0A2W7FAE3 | 144-224 | None |
| A0A7Y0A1J4 | 1-71 | None |
| A0A2S9LNW3 | 173-253 | None |
| A0A1X7M7K8 | 186-272 | None |
| A0A6P3B6C4 | 172-237 | None |
| A0A158D837 | 47-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.