DPCstruct | MC458
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 194 ± 28 aa |
| Standard deviation of domain lengths | 28.44 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 14.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A419EF79 | 1-173 | MNIEYRQEYEPELTAKVRARFADEMNRLRAFGFSDFGCYSELLPNYSLFTHFIIFLLAKANREIIRVESPLRLVMSQPLLVQREQST… |
| A0A2U8E043 | 19-238 | IGLWLGFQIVRLLSVVRFLGKTKFTGNRITPVAENDTPVWLRELAITQESVLLGEGFVRRHEHTIQLAIHADIPIPCIEYILPGQGV… |
| A0A525CCG6 | 7-177 | None |
| A0A4Q2XW45 | 128-313 | None |
| A0A2V7ST77 | 3-187 | None |
| A0A517P2E4 | 50-220 | None |
| A0A517NVV8 | 407-569 | None |
| A0A3D3NWJ6 | 53-257 | None |
| A0A6N6Q3C0 | 32-244 | None |
| A0A517PVL2 | 15-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.