DPCstruct | MC45796
Metacluster Properties and Pfam Annotations
| Number of structural domains | 121 |
|---|---|
| Mean domain length (aa) | 240 ± 51 aa |
| Standard deviation of domain lengths | 50.91 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 21.94 |
| Pfam Score | 99.40 |
| Assigned Pfam label(s) | PF11719- PF06999 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D2K0P3 | 20-236 | PEMYSTNIANSITPYGRHVFVHYKTPEAWPFNVEEEGQPQLFAKLLKSRKSELPVQTKLNACEGDGSDGDVLIFPDMVRYKGLKDAD… |
| A0A2T6ZBZ4 | 43-307 | ITEKCPPSCACSLESLPEDLDIDRVTSLKGTMANYYRHLLVCTGHSDWASKIELDIAEPGGGLAGRIKELTAMRGGGRKDLRDPFSP… |
| A0A6A4P981 | 1-211 | None |
| A0A6A4PXZ4 | 20-229 | None |
| A0A4Y7JEL2 | 15-222 | None |
| A0A1Y2HE17 | 103-315 | None |
| A0A0M8N1P3 | 52-297 | None |
| A0A1E4SM20 | 14-233 | None |
| A0A061RM99 | 38-298 | None |
| W4GLP3 | 26-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.