DPCstruct | MC45794
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 224 ± 63 aa |
| Standard deviation of domain lengths | 62.67 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 77.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 26.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A228HMJ0 | 12-240 | KLTRTEFAVVRAYAQGMRPVDIANRYLLDPDEDEHLSEAQAIQRILALRDRLVQFALQHGRPEIAGMFEALRARSGVGMSRRVDAVS… |
| W7W179 | 54-331 | KLHVGHFAFMRSVVQGLDPRESWERYFRVEGEATNQRTVRATIAWIRDEFAAAAKREDRFGTARLVRIDATRIADPSLELPSLEAFA… |
| A0A158KT82 | 165-332 | None |
| A0A7X3HMC0 | 14-221 | None |
| A0A2L0X2N5 | 32-326 | None |
| A0A6S7BJT6 | 1-153 | None |
| A0A5C6TPZ3 | 1-371 | None |
| A0A1I7ELR6 | 5-144 | None |
| A0A6B3SGX1 | 13-284 | None |
| A0A242MBC9 | 6-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.