DPCstruct | MC45793
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 188 ± 19 aa |
| Standard deviation of domain lengths | 19.28 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 22.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A257UAI4 | 1-189 | MLLVVAVLAVGCAKPPQQEIDGAKAALTAAEQAEAPKYAADAWDKAQQAMNAVNAELEAQQAKFALFRSYTKGKQLIADATNAANAA… |
| A0A0M3QFB5 | 2-163 | DAAVTEGAANYAAEDFAKVEGALVAALEEVKTQDGKMLKNYDKAKQMLAQAKADSEALQAKTVAEKQRLMDQAVADLAAAGTAVATA… |
| A0A6A7L160 | 159-376 | None |
| A0A806K2S4 | 1-193 | None |
| A0A351HNS1 | 19-216 | None |
| A0A1F9RS14 | 2-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.