DPCstruct | MC45792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 150 ± 15 aa |
| Standard deviation of domain lengths | 15.26 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 69.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A286U4K2 | 16-179 | FLEVASVTTSLSVETNVGIDAIIPFSKAHNTLEPGLGFKESTKPTITYTPLRGEDFLKSVLSPISLDAILLMTQSGWSIERVFGVCI… |
| A0A7Y4SHJ0 | 1-167 | MHFTAVSSVAATFDFRTSAGIRGGFGPTIASRDRLLNLEYSASIAENPTITIVPITGEEFTKRILQPLDEGKFEFLVRQGYAINMVL… |
| A0A2V3QNA6 | 73-200 | None |
| A0A3N5HFY2 | 67-214 | None |
| A0A1F4E1A5 | 55-186 | None |
| A0A7W2YJR8 | 30-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.