DPCstruct | MC4579
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 220 ± 29 aa |
| Standard deviation of domain lengths | 28.84 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 21.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q7JRR2 | 2-200 | TRVALERGRTWTFAAALDWPGWCRRAKTRDGDEAALEALLAYAGRYALVVGEEFAPGDLEVVGAVAGDTTTDFGAPAVAGPWDDVSL… |
| A0A847FKS3 | 1-240 | MTRYAVYLERAEGGLCMAHVPALPGCMVRATGRDEALGALPGAIRAYHAWLRDHGEAAPGEAEPVALEVAGEVEGTGPFNPGDAAAL… |
| A0A6L6R797 | 7-155 | None |
| A0A6L3EV67 | 1-241 | None |
| A0A2V1HT73 | 1-211 | None |
| A0A3L6JA41 | 56-309 | None |
| A0A402APT3 | 2-187 | None |
| A0A535RUA6 | 3-207 | None |
| A0A399WRV8 | 12-210 | None |
| A0A7J3RX02 | 11-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.