DPCstruct | MC45787
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 428 ± 45 aa |
| Standard deviation of domain lengths | 45.26 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 52.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820VXM0 | 2-423 | LAKGLGLKENQPRDMKQAIIEEKLGVYKTRDWEKYTFFKHWIIFDARKQKLHIVYGMQANDLRMLIGGAKPIDQLTDPTQRDARAHI… |
| A0A815AU48 | 149-563 | SIENLRDALSLKSDEARDMVQAIIEEKLGIYTRSDWQEKEFFKHWIIFNARKQELEVVYGMTAEDLRILIGGAKPIHHLTDPAQRDA… |
| A0A819T7B1 | 116-595 | None |
| A0A817N5W3 | 153-574 | None |
| A0A814U8W0 | 147-560 | None |
| A0A814VCC6 | 83-603 | None |
| A0A819PS52 | 6-370 | None |
| A0A819MLA7 | 197-609 | None |
| A0A818CP49 | 151-606 | None |
| A0A821YUE3 | 4-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.