DPCstruct | MC45783
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 506 ± 114 aa |
| Standard deviation of domain lengths | 114.05 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 81.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF20255- PF12340 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820U798 | 108-713 | LLEDHFIDELIIRLDRRLDDCELNWQNELVLVTITMITMRMLTICNSIRQDKVTDLVIKCRRIGERWISLISENIKTSSPSAFDKID… |
| A0A5M9MIC8 | 11-339 | TIRGMLIRDIQMTVSIQGLLQSTIQCHPESLQLAISSMWPDTADRPRTYRPWRYISKSDMWMVSTATASDLSRPQLVHYHILEGHLL… |
| A0A117NSF3 | 3-738 | None |
| A0A5N6E6D4 | 245-932 | None |
| C4JQK6 | 75-617 | None |
| A0A420H8R7 | 202-820 | None |
| A0A4U0WGT1 | 450-906 | None |
| A0A0D0AEL5 | 281-987 | None |
| A0A0F8W2Z9 | 2-316 | None |
| A0A2C5YEK5 | 5-590 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.