DPCstruct | MC4578
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 91 ± 5 aa |
| Standard deviation of domain lengths | 5.42 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 24.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090QTY0 | 4-92 | FQNAELDALLDKFYKTAKLEEQQDIAHQIQQIIAENQVTVPVMSGVDVYQFNESRFTGWWSESNPKGRPLSWAGVPERLLHVLDLKP… |
| A0A7X9J640 | 8-102 | YDNQTVFDLVDQLDATPITDEAGMKSIISQIQAIQLQDVPMIPLWYNGVWAQMNTANWTNWPSSADGAPKYYPATWNGYWNMGAVLM… |
| A0A328VMX4 | 15-116 | None |
| A0A645IDP9 | 85-175 | None |
| A0A535NYS3 | 51-140 | None |
| A0A353MP66 | 132-221 | None |
| A0A843I4J3 | 36-131 | None |
| A0A7C4NG34 | 192-281 | None |
| A0A535X5Z7 | 1-79 | None |
| A0A0U3R5R1 | 42-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.