DPCstruct | MC45773
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 79 ± 7 aa |
| Standard deviation of domain lengths | 7.41 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I3S0K9 | 1-83 | MVVEKVEKIVEPKMKLKKLCKQILNQAPGESLKLKQLKVLIEQHSSSILSDFSSKREAVAYLKQKLTGSRKFCIEGKTVRLAF |
| A0A4D8YZN3 | 208-273 | LKKLCRQLLEQAPGESMKLKQLKLLVDEHSPSTFSNLSKEEALAFLLQKLENSDRFLVKRNKVLLV |
| A0A2I0HY54 | 187-279 | None |
| A0A7J7MRQ9 | 359-440 | None |
| A0A0A8XS57 | 16-99 | None |
| A0A022QL72 | 421-494 | None |
| M0URH3 | 133-214 | None |
| A0A7N1A5N1 | 65-146 | None |
| A0A0E0FNL3 | 602-671 | None |
| A0A0V1MUS3 | 521-597 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.