DPCstruct | MC45772
Metacluster Properties and Pfam Annotations
| Number of structural domains | 95 |
|---|---|
| Mean domain length (aa) | 351 ± 81 aa |
| Standard deviation of domain lengths | 81.15 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 82.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.85 |
| Pfam Score | 84.36 |
| Assigned Pfam label(s) | CL0590- CL0229- PF06001- CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G7ZY55 | 21-372 | RKTNDEVINEPWVQCNKYLHCNSVYTCPLCRINEIKNGIQIPLKDIWTAFGTKDLPKTVLSDHIEKRLFERLMQEREERQKIEGNEN… |
| A0A182SGD1 | 87-348 | PFVDCLDCGRKQHQICVLYLESIWPGGFVCDACLKKKGQKRKDNKFNAKRLPTSKLGTYIETRVNNFLKKKEAGAGEVHIRVVSSSD… |
| A0A182U6N4 | 19-413 | None |
| A0A7R9U6P2 | 348-652 | None |
| A0A0L9UT52 | 76-460 | None |
| G0P2H3 | 38-230 | None |
| A0A287XFW3 | 283-645 | None |
| A0A1D2NDH3 | 33-412 | None |
| A0A7E4W0D6 | 323-847 | None |
| A0A7S1UT71 | 57-460 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.