DPCstruct | MC4577
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 84 ± 8 aa |
| Standard deviation of domain lengths | 7.55 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 31.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4HYF0 | 1-85 | MGRNAATYRQLLEEEVRGWSSFREALRREEREAFDNLVNQAFRYVHAGTMNPLRRTFDNLTMSLLLSHEERLRQLEENLRKTMQI |
| A0A7C6NU18 | 1-84 | MGRTIASITQTWQQEEAALKRFKRALRKEDQILLDELLVLSRLHLAEASYASNLYPLDMYLIAILLEVYKQLKATQRALNDGID |
| A0A6L3F103 | 33-116 | None |
| A0A3N5V662 | 1-69 | None |
| A0A654M2K3 | 1-77 | None |
| A0A133UIZ7 | 1-83 | None |
| A0A534IE28 | 1-77 | None |
| A0A2D5KGT7 | 26-109 | None |
| A0A7J3BBJ2 | 14-101 | None |
| A0A537LL87 | 1-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.