DPCstruct | MC45766
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 188 ± 25 aa |
| Standard deviation of domain lengths | 24.55 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 26.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7BLG6 | 1-195 | MANADKEKNREIEFVVNGYSFETQEEYEKALEEKKSIERLMKKVNLNKGELLVALYSGLITQNKLSTVIGLEYLCRLRDIIINKKYA… |
| A0A1G9VY51 | 28-216 | AKEKKEKAFVVGGYNFKTSQEAEAAKDEMAAIKYLSSKTDSKDPKQVFILYNKIIDRQLFTTSLGISYLKNLQQFLYQSPSIPNDRI… |
| A0A7C6MXE1 | 1-135 | None |
| R7C6R2 | 3-182 | None |
| A0A1H7FZL8 | 13-206 | None |
| A0A3A9FCK8 | 40-217 | None |
| A0A1I2N700 | 3-233 | None |
| R5NVS9 | 23-196 | None |
| A0A1I5VFD9 | 1-218 | None |
| A0A1H3HK52 | 3-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.