DPCstruct | MC45760
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 171 ± 21 aa |
| Standard deviation of domain lengths | 21.43 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 27.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F8T8C2 | 1-174 | MYLISKKGLHFLYTKRGTISQESDFIDGYDDWVSTKNWDAMKAAWMAVGKEQRDVPVHVANEYCRKDRSFDPTPQFNEDKFPRGLAF… |
| A0A0W1A662 | 85-227 | VVHGFLEASNAWCADFPNRTLEERVHHLVEDVGEAQAKFPAHILQEYCHPIRAFDPIPKFSEAELPESLNFYNWNCLQTTSILVSSP… |
| A0A516MZY0 | 443-644 | None |
| A0A0W0ST38 | 247-418 | None |
| A0A448NCF3 | 58-217 | None |
| A0A0W0VWV7 | 210-380 | None |
| A0A0W0VZF9 | 32-172 | None |
| A0A0A8UMI1 | 643-843 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.